Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB25 Peptide - C-terminal region

RAB25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATX-8, RAB11C

UniProt

P57735

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB25 Rabbit Polyclonal Antibody (orb589798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065120.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF1 Knockout HGC-27 Polyclonal Cells
ARG29598 1 Million

ARHGEF1 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
20, (5β) -PREGNEN-3α-OL
503820 Inquire

20, (5β) -PREGNEN-3α-OL

Sign In for Pricing
View Details
Integrin Beta-1 (CD29) Antibody (FITC)
abx413997 0.5 mg

Integrin Beta-1 (CD29) Antibody (FITC)

Sign In for Pricing
View Details
Human YL1 (VPS72) (NM_005997) AAV Particle
RC201273A1V 250 µL

Human YL1 (VPS72) (NM_005997) AAV Particle

Sign In for Pricing
View Details
Iqub ORF Vector (Rat) (pORF)
25070016 1.0 µg DNA

Iqub ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal ZC3H7A Antibody (PCRP-ZC3H7A-1D6) [DyLight 680]
NBP3-14047FR 0.1 mL

Mouse Monoclonal ZC3H7A Antibody (PCRP-ZC3H7A-1D6) [DyLight 680]

Sign In for Pricing
View Details