Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB25 Peptide - C-terminal region

RAB25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CATX-8, RAB11C

UniProt

P57735

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB25 Rabbit Polyclonal Antibody (orb589798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065120.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
48725116 3x 1.0 µg

Ttll12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Polyclonal Cysteine Dioxygenase / CDO1 Antibody (N-Terminus)
APR07473G 0.05mg

Polyclonal Cysteine Dioxygenase / CDO1 Antibody (N-Terminus)

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody
CQA4227-01 30 µL

Anti-DCUN1D1 Antibody

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody
CQA4227-02 50 μL

Anti-DCUN1D1 Antibody

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody
CQA4227-03 100 µL

Anti-DCUN1D1 Antibody

Sign In for Pricing
View Details
Anti-DCUN1D1 Antibody
CQA4227-04 200 µL

Anti-DCUN1D1 Antibody

Sign In for Pricing
View Details