Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - C-terminal region

CCKAR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1R, CCKRA, CCK1-R

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb589904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000721.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-D-Thr (t-Bu) TentaGel® S AC Resin
SAD1124.1G 1 g

Fmoc-D-Thr (t-Bu) TentaGel® S AC Resin

Sign In for Pricing
View Details
Porcine Cadherin, Neuronal ELISA kit
GTR10436346 96 Well

Porcine Cadherin, Neuronal ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal CD20 Antibody (OTI4B4) [Dylight 594]
NBP2-70362DL594 0.1 mL

Mouse Monoclonal CD20 Antibody (OTI4B4) [Dylight 594]

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS801288 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
DIP13B Antibody
orb1326687 100 µg

DIP13B Antibody

Sign In for Pricing
View Details
SPC24 CRISPRa sgRNA lentivector (set of three targets)(Human)
45241121 3x 1.0µg DNA

SPC24 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details