Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - C-terminal region

CCKAR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1R, CCKRA, CCK1-R

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb589904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000721.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exoc8 (NM_139043) Rat Tagged ORF Clone Lentiviral Particle
RR215266L3V 200 µL

Exoc8 (NM_139043) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CASK (C-6) AC
sc-13158 AC 500 µg/mL - 25% ag

CASK (C-6) AC

Sign In for Pricing
View Details
Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit
ELK9180-01 48 Tests

Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit

Sign In for Pricing
View Details
Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit
ELK9180-02 96 Tests

Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit

Sign In for Pricing
View Details
Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit
ELK9180-03 5x 96 Tests

Rabbit NF-κB p105 (Nuclear factor NF-kappa-B p105 subunit) ELISA Kit

Sign In for Pricing
View Details
Methylmalonyl Coenzyme A mutase Rabbit Polyclonal Antibody (HRP)
orb2616034 100 µg

Methylmalonyl Coenzyme A mutase Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details