Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT2 Peptide - middle region

GALNT2 Peptide - middle region

Product Specifications

Product Name Alternative

GalNAc-T2

UniProt

Q10471

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT2 Rabbit Polyclonal Antibody (orb589908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004472.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-01 0.1 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-02 0.2 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-03 0.5 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-04 1 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-05 5 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2005135-06 5x 5 mL

Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details