GALNT2 Peptide - middle region
GALNT2 Peptide - middle region
Product Specifications
Product Name Alternative
GalNAc-T2
UniProt
Q10471
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GALNT2 Rabbit Polyclonal Antibody (orb589908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004472.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP42397_P050-HRP 100 µL
CLEC4M Antibody - middle region : HRP (ARP42397_P050-HRP)
Sign In for Pricing
View Details 
125701-PE 100 µL
DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (PE)
Sign In for Pricing
View Details