Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Peptide - middle region

GIT2 Peptide - middle region

Product Specifications

Product Name Alternative

CAT2, CAT-2

UniProt

Q14161

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIT2 Rabbit Polyclonal Antibody (orb589909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001128685.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDMEPDGMGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxprenoate Free Base
orb1740781-01 25 mg

Oxprenoate Free Base

Sign In for Pricing
View Details
Oxprenoate Free Base
orb1740781-02 50 mg

Oxprenoate Free Base

Sign In for Pricing
View Details
Oxprenoate Free Base
orb1740781-03 100 mg

Oxprenoate Free Base

Sign In for Pricing
View Details
Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit
MBS7274160-01 48 Well

Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit
MBS7274160-02 96 Well

Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit
MBS7274160-03 5x 96 Well

Guinea Pig Anti-neuronal nuclear antibody, type 1 ELISA Kit

Sign In for Pricing
View Details