HSPH1 Peptide - middle region
HSPH1 Peptide - middle region
Product Specifications
Product Name Alternative
HSP105, HSP105A, HSP105B, NY-CO-25
UniProt
Q92598
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPH1 Rabbit Polyclonal Antibody (orb589910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001273432.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6222027-01 0.1 mL
EPB42 (Erythrocyte Membrane Protein Band 4.2, Erythrocyte Protein 4.2, P4.2, E42P) (MaxLight 650)
Sign In for Pricing
View Details MBS6222027-02 5x 0.1 mL
EPB42 (Erythrocyte Membrane Protein Band 4.2, Erythrocyte Protein 4.2, P4.2, E42P) (MaxLight 650)
Sign In for Pricing
View Details