Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDFIP1 Peptide - middle region

NDFIP1 Peptide - middle region

Product Specifications

Product Name Alternative

N4WBP5

UniProt

Q9BT67

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDFIP1 Rabbit Polyclonal Antibody (orb589912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_085048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-miR-134-5p Virus
mr0519 250 µL

AdmiRa-rno-miR-134-5p Virus

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 59 (CD59)
MBS2152443-01 0.1 mL

Monoclonal Antibody to Cluster of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 59 (CD59)
MBS2152443-02 0.2 mL

Monoclonal Antibody to Cluster of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 59 (CD59)
MBS2152443-03 0.5 mL

Monoclonal Antibody to Cluster of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 59 (CD59)
MBS2152443-04 1 mL

Monoclonal Antibody to Cluster of Differentiation 59 (CD59)

Sign In for Pricing
View Details
Monoclonal Antibody to Cluster of Differentiation 59 (CD59)
MBS2152443-05 5 mL

Monoclonal Antibody to Cluster of Differentiation 59 (CD59)

Sign In for Pricing
View Details