Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDFIP1 Peptide - middle region

NDFIP1 Peptide - middle region

Product Specifications

Product Name Alternative

N4WBP5

UniProt

Q9BT67

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDFIP1 Rabbit Polyclonal Antibody (orb589912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_085048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr47 (NM_001100702) Rat Tagged Lenti ORF Clone
RR201393L4 10 µg

Wdr47 (NM_001100702) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)
245454-PE 100 µL

DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)

Sign In for Pricing
View Details
Anti-KCNN3 Antibody
A03865-1 100 µL

Anti-KCNN3 Antibody

Sign In for Pricing
View Details
PRKAR2B antibody
70R-50252 100 µL

PRKAR2B antibody

Sign In for Pricing
View Details
DSP-2
GW5273-5mg 5 mg

DSP-2

Sign In for Pricing
View Details
NNMT Recombinant Protein (Human)
OPCA04907-20UG 20 µg

NNMT Recombinant Protein (Human)

Sign In for Pricing
View Details