SESN1 Peptide - middle region
SESN1 Peptide - middle region
Product Specifications
Product Name Alternative
PA26, SEST1
UniProt
Q9Y6P5
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SESN1 Rabbit Polyclonal Antibody (orb589913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001186862.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
28423154 3x 1.0 µg DNA
METTL7B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 
MBS6439698-01 0.1 mL
SYN1, Phosphorylated (S549) (Synapsin I, SYNI, SYN1a, SYN1b) (Biotin)
Sign In for Pricing
View Details MBS6439698-02 5x 0.1 mL
SYN1, Phosphorylated (S549) (Synapsin I, SYNI, SYN1a, SYN1b) (Biotin)
Sign In for Pricing
View Details