Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SESN1 Peptide - middle region

SESN1 Peptide - middle region

Product Specifications

Product Name Alternative

PA26, SEST1

UniProt

Q9Y6P5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SESN1 Rabbit Polyclonal Antibody (orb589913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001186862.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTRHD1 Rabbit Polyclonal Antibody (PE-Cy7)
orb966418 100 µL

PTRHD1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
DRAK1 Antibody
24073 100 µL

DRAK1 Antibody

Sign In for Pricing
View Details
CD34 Polyclonal Antibody
bs-2038R-TR 20 µL

CD34 Polyclonal Antibody

Sign In for Pricing
View Details
C1orf147 Polyclonal Antibody, Cy5.5 Conjugated
bs-15025R-Cy5.5 100 µL

C1orf147 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Magnetic field of current Set/3
1070360/6 1 Each

Magnetic field of current Set/3

Sign In for Pricing
View Details
RPS15AP15 CRISPR Knock Out 293T Cell Line (Human)
42112141 1x 10^6 Cells / 1.0 mL

RPS15AP15 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details