FAN1 Peptide - N-terminal region
FAN1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KMIN, hFAN1, MTMR15, KIAA1018
UniProt
Q9Y2M0
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAN1 Rabbit Polyclonal Antibody (orb589920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001139566.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471283-100 1x 100 µL
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details