Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK11 Peptide - middle region

KLK11 Peptide - middle region

Product Specifications

Product Name Alternative

TLSP, PRSS20

UniProt

Q9UBX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK11 Rabbit Polyclonal Antibody (orb589922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001129504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAG1 (GPAT3) (NM_032717) Human Over-expression Lysate
LC403194 20 µg

MAG1 (GPAT3) (NM_032717) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Mog activation kit by CRISPRa
GA202694 1 Kit

Mouse Mog activation kit by CRISPRa

Sign In for Pricing
View Details
Hexokinase 1 Recombinant Rabbit Monoclonal Antibody [ST47-05]
ET1609-28 100 µL

Hexokinase 1 Recombinant Rabbit Monoclonal Antibody [ST47-05]

Sign In for Pricing
View Details
LATS1 Human Gene Knockout Kit (CRISPR)
KN423650 1 Kit

LATS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UNCX (C-term) Rabbit Polyclonal Antibody
AP54463PU-N 400 µL

UNCX (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PFKM (NM_000289) Human Over-expression Lysate
LC424822 20 µg

PFKM (NM_000289) Human Over-expression Lysate

Sign In for Pricing
View Details