Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK11 Peptide - middle region

KLK11 Peptide - middle region

Product Specifications

Product Name Alternative

TLSP, PRSS20

UniProt

Q9UBX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK11 Rabbit Polyclonal Antibody (orb589922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001129504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COT2 Antibody
8C10471-AAT 50 µg

COT2 Antibody

Sign In for Pricing
View Details
Piperidine-2,6-dicarboxylic Acid
TRC-P475315-50MG 50 mg

Piperidine-2,6-dicarboxylic Acid

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3337), CF740 conjugate, 0.1mg/mL
BNC743337-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3337), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SAM68 Antibody
RC-16145-01 50 μL

Recombinant SAM68 Antibody

Sign In for Pricing
View Details
Recombinant SAM68 Antibody
RC-16145-02 100 µL

Recombinant SAM68 Antibody

Sign In for Pricing
View Details
Recombinant SAM68 Antibody
RC-16145-03 1 mL

Recombinant SAM68 Antibody

Sign In for Pricing
View Details