Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT2 Peptide - middle region

NIT2 Peptide - middle region

Product Specifications

Product Name Alternative

HEL-S-8a

UniProt

Q9NQR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIT2 Rabbit Polyclonal Antibody (orb589927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064587.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Wolfram Syndrome Protein 1 ELISA Kit
MBS106814-01 48 Well

Camel Wolfram Syndrome Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Wolfram Syndrome Protein 1 ELISA Kit
MBS106814-02 96 Well

Camel Wolfram Syndrome Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Wolfram Syndrome Protein 1 ELISA Kit
MBS106814-03 5x 96 Well

Camel Wolfram Syndrome Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Wolfram Syndrome Protein 1 ELISA Kit
MBS106814-04 10x 96 Well

Camel Wolfram Syndrome Protein 1 ELISA Kit

Sign In for Pricing
View Details
Fluor Violet 450 Anti-Mouse TCRbeta Antibody [H57-597 (HB218)]
MBS2570381-01 0.025 mg

Fluor Violet 450 Anti-Mouse TCRbeta Antibody [H57-597 (HB218)]

Sign In for Pricing
View Details
Fluor Violet 450 Anti-Mouse TCRbeta Antibody [H57-597 (HB218)]
MBS2570381-02 0.1 mg

Fluor Violet 450 Anti-Mouse TCRbeta Antibody [H57-597 (HB218)]

Sign In for Pricing
View Details