Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT2 Peptide - middle region

NIT2 Peptide - middle region

Product Specifications

Product Name Alternative

HEL-S-8a

UniProt

Q9NQR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIT2 Rabbit Polyclonal Antibody (orb589927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064587.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLD2 3'UTR GFP Stable Cell Line
TU068224 1.0 mL

PLD2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(S) -Tetrahydrofuran-3-ol
HY-76476 25 g

(S) -Tetrahydrofuran-3-ol

Sign In for Pricing
View Details
Lentiviral mouse Lrrc36 shRNA (UAS) - Lentiviral mouse Lrrc36 shRNA (UAS, GFP) (100)
GTR15243537 1 Vial

Lentiviral mouse Lrrc36 shRNA (UAS) - Lentiviral mouse Lrrc36 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Ralimetinib (LY2228820) dimesylate
S1494-50mg 50 mg

Ralimetinib (LY2228820) dimesylate

Sign In for Pricing
View Details
Compound NP-024481
T128008-01 10 mg

Compound NP-024481

Sign In for Pricing
View Details
Compound NP-024481
T128008-02 1 g

Compound NP-024481

Sign In for Pricing
View Details