Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EHD3 Peptide - N-terminal region

EHD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAST3

UniProt

Q9NZN3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EHD3 Rabbit Polyclonal Antibody (orb589930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DNAL1 Antibody (29E4) [Alexa Fluor 350]
NBP2-42657AF350 100 µL

Mouse Monoclonal DNAL1 Antibody (29E4) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human/Mouse/Rat Amphiphysin/AMPH Affinity Purified PAb
AF6527-SP 25 µg

Human/Mouse/Rat Amphiphysin/AMPH Affinity Purified PAb

Sign In for Pricing
View Details
Muted (F-4) : m-IgG Fc BP-HRP Bundle
sc-530493 1 Kit

Muted (F-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
CALM2 Human 135 a.a
OM303814-01 10 µg

CALM2 Human 135 a.a

Sign In for Pricing
View Details
CALM2 Human 135 a.a
OM303814-02 50 µg

CALM2 Human 135 a.a

Sign In for Pricing
View Details
CALM2 Human 135 a.a
OM303814-03 1 mg

CALM2 Human 135 a.a

Sign In for Pricing
View Details