Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA1 Peptide - middle region

HTRA1 Peptide - middle region

Product Specifications

Product Name Alternative

L56, HtrA, ARMD7, ORF480, PRSS11, CARASIL, CADASIL2

UniProt

Q92743

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTRA1 Rabbit Polyclonal Antibody (orb588121) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002766

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific,
AAF-521-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific,

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL
BNC471725-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf38 (THEMIS2) Human qPCR Primer Pair (NM_004848)
HP225776 200 Reactions

C1orf38 (THEMIS2) Human qPCR Primer Pair (NM_004848)

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)
PKSH032169-01 10 µg

Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)
PKSH032169-02 50 µg

Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)

Sign In for Pricing
View Details