Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL5RA Peptide - N-terminal region

IL5RA Peptide - N-terminal region

Product Specifications

Product Name Alternative

IL5R, CD125, CDw125, HSIL5R3

UniProt

Q01344

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL5RA Rabbit Polyclonal Antibody (orb588128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_783855

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Aldh1a2 shRNA (UAS) - Lentiviral mouse Aldh1a2 shRNA (UAS, RFP) (100)
GTR15252384 1 Vial

Lentiviral mouse Aldh1a2 shRNA (UAS) - Lentiviral mouse Aldh1a2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human IgG1 fut Isotype Control Antibody (13R4)
HP855107 100 µg

Human IgG1 fut Isotype Control Antibody (13R4)

Sign In for Pricing
View Details
Dld (NM_199385) Rat Untagged Clone
RN201558 10 µg

Dld (NM_199385) Rat Untagged Clone

Sign In for Pricing
View Details
Bouin's Fluid (Histopathology Fixative) (Bouin's Picro Formal Fixing Solution)
46700100 100 mL

Bouin's Fluid (Histopathology Fixative) (Bouin's Picro Formal Fixing Solution)

Sign In for Pricing
View Details
LRRTM1 Human shRNA Lentiviral Particle (Locus ID 347730)
TL303424V 500 µL Each

LRRTM1 Human shRNA Lentiviral Particle (Locus ID 347730)

Sign In for Pricing
View Details
EEF1B2 Peptide - middle region (AAP52399)
AAP52399-100UG 100 µg

EEF1B2 Peptide - middle region (AAP52399)

Sign In for Pricing
View Details