CEACAM8 Peptide - middle region
CEACAM8 Peptide - middle region
Product Specifications
Product Name Alternative
CD67, CGM6, CD66b, NCA-95
UniProt
P31997
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEACAM8 Rabbit Polyclonal Antibody (orb589554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001807.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45O54744M2-100 100 µg
Influenza A H5N1 (A/Anhui/1/2005) Hemagglutinin / HA Protein (His Tag)
Sign In for Pricing
View Details 
