MC5R Peptide - middle region
MC5R Peptide - middle region
Product Specifications
Product Name Alternative
MC2
UniProt
P33032
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MC5R Rabbit Polyclonal Antibody (orb589564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005904.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DSMICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC434186 20 µg
C10orf81 (PLEKHS1) (NM_001193434) Human Over-expression Lysate
Sign In for Pricing
View Details 
KN212386BN 1 Kit
C6orf150 (MB21D1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
ICH1066-100mg 100 mg
Anti-Mouse CD90.2 (30-H12) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details