MC5R Peptide - middle region
MC5R Peptide - middle region
Product Specifications
Product Name Alternative
MC2
UniProt
P33032
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MC5R Rabbit Polyclonal Antibody (orb589564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005904.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DSMICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP304215L 1 mg
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC680479-500 1x 500 µL
CD32 (Fc Gamma RIIa) (FCGR2A/479), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940843-500 1x 500 µL
CD106 / VCAM1 (VCAM1/843), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY422978 100 µg
Epigen (EPGN) (NM_001013442) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC423718 20 µg
CD32 (FCGR2C) (NM_001005411) Human Over-expression Lysate
Sign In for Pricing
View Details