HGS Peptide - C-terminal region
HGS Peptide - C-terminal region
Product Specifications
Product Name Alternative
HRS
UniProt
O14964
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGS Rabbit Polyclonal Antibody (orb589580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004703.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM3019-50 1x 50 µL
CD47 / IAP (Integrin Associated Protein) (CD47/3019), 1mg/mL
Sign In for Pricing
View Details 
BNCB2886-500 1x 500 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740636-500 1x 500 µL
Human Lambda Light Chain (LAM03), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 