HGS Peptide - C-terminal region
HGS Peptide - C-terminal region
Product Specifications
Product Name Alternative
HRS
UniProt
O14964
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGS Rabbit Polyclonal Antibody (orb589580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004703.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742287-100 1x 100 µL
SOX9 / SRY-box 9 (SOX9/2287R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC403171-500 1x 500 µL
CD3e (T-Cell Marker) (C3e/3171R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682558-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details