Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD46 Peptide - middle region

CD46 Peptide - middle region

Product Specifications

Product Name Alternative

MCP, TLX, AHUS2, MIC10, TRA2.10

UniProt

P15529

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD46 Rabbit Polyclonal Antibody (orb589593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002380.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1) (MaxLight 750) discontinued
124680-ML750 100 µL

CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACTG1 siRNA Oligos set (Human)
11245171 3x 5 nmol

ACTG1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SYP Polyclonal Antibody
MBS2535965-01 0.02 mL

SYP Polyclonal Antibody

Sign In for Pricing
View Details
SYP Polyclonal Antibody
MBS2535965-02 0.06 mL

SYP Polyclonal Antibody

Sign In for Pricing
View Details
SYP Polyclonal Antibody
MBS2535965-03 0.12 mL

SYP Polyclonal Antibody

Sign In for Pricing
View Details
SYP Polyclonal Antibody
MBS2535965-04 0.2 mL

SYP Polyclonal Antibody

Sign In for Pricing
View Details