Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUND Peptide - middle region

JUND Peptide - middle region

Product Specifications

Product Name Alternative

AP-1

UniProt

P17535

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JUND Rabbit Polyclonal Antibody (orb589626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001273897.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken major histocompatibility complex-II (MHC II) ELISA Kit
MBS267385-01 48 Well

Chicken major histocompatibility complex-II (MHC II) ELISA Kit

Sign In for Pricing
View Details
Chicken major histocompatibility complex-II (MHC II) ELISA Kit
MBS267385-02 96 Well

Chicken major histocompatibility complex-II (MHC II) ELISA Kit

Sign In for Pricing
View Details
Chicken major histocompatibility complex-II (MHC II) ELISA Kit
MBS267385-03 5x 96 Well

Chicken major histocompatibility complex-II (MHC II) ELISA Kit

Sign In for Pricing
View Details
Chicken major histocompatibility complex-II (MHC II) ELISA Kit
MBS267385-04 10x 96 Well

Chicken major histocompatibility complex-II (MHC II) ELISA Kit

Sign In for Pricing
View Details
Protein Phosphatase 2B (PP2B, Calcineurin) discontinued
P9107-35 1 mg

Protein Phosphatase 2B (PP2B, Calcineurin) discontinued

Sign In for Pricing
View Details
Penthiopyrad
TRC-P275570-100MG 100 mg

Penthiopyrad

Sign In for Pricing
View Details