Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERPUD1 Peptide - middle region

HERPUD1 Peptide - middle region

Product Specifications

Product Name Alternative

SUP, HERP, Mif1

UniProt

Q15011

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HERPUD1 Rabbit Polyclonal Antibody (orb589867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001010989.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDP1 Recombinant Rabbit Monoclonal Antibody [PSH0-93]
HA721531 100 µL

TDP1 Recombinant Rabbit Monoclonal Antibody [PSH0-93]

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/3388), CF405S conjugate, 0.1mg/mL
BNC043388-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/3388), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retn (NM_022984) Mouse Tagged ORF Clone
MG200462 10 µg

Retn (NM_022984) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ethanol-d6
TRC-E890124-500MG 500 mg

Ethanol-d6

Sign In for Pricing
View Details
(+)-1,2-Bis((2S,5S)-2,5-diphenylphospholano)ethane
TRC-B430420-250MG 250 mg

(+)-1,2-Bis((2S,5S)-2,5-diphenylphospholano)ethane

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561178 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details