STX16 Peptide - middle region
STX16 Peptide - middle region
Product Specifications
Product Name Alternative
SYN16
UniProt
O14662
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STX16 Rabbit Polyclonal Antibody (orb589876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001001433.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401179 20 µg
ARD1A (NAA10) (NM_003491) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNCB0841-100 1x 100 µL
Pgp9.5 (UCHL-1) (UCHL1/841), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC419177 20 µg
Plexin B1 (PLXNB1) (NM_002673) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC041331-250 1x 250 µL
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF405S Conjugate, 0.1 mg/mL
Sign In for Pricing
View Details 