Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX16 Peptide - middle region

STX16 Peptide - middle region

Product Specifications

Product Name Alternative

SYN16

UniProt

O14662

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STX16 Rabbit Polyclonal Antibody (orb589876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001001433.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2-Dibromo-1-(4-fluorophenyl)-2-phenylethanone
TRC-D426250-250MG 250 mg

2,2-Dibromo-1-(4-fluorophenyl)-2-phenylethanone

Sign In for Pricing
View Details
Uncoated Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit
E-UNEL-M0129-01 5x 96 Tests

Uncoated Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit
E-UNEL-M0129-02 15x 96 Tests

Uncoated Mouse bFGF/FGF2 (Basic Fibroblast Growth Factor) ELISA Kit

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL
BNC682045-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LAS1L activation kit by CRISPRa
GA113147 1 Kit

Human LAS1L activation kit by CRISPRa

Sign In for Pricing
View Details
Human phospholipid scramblase 2 (PLSCR2) activation kit by CRISPRa
GA111348 1 Kit

Human phospholipid scramblase 2 (PLSCR2) activation kit by CRISPRa

Sign In for Pricing
View Details