Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK3 Peptide - C-terminal region

MAPKAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3PK, MK-3, MAPKAP3, MAPKAP-K3, MAPKAPK-3

UniProt

Q16644

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK3 Rabbit Polyclonal Antibody (orb589935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001230854.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CreA Antibody
orb812593 2 mg

CreA Antibody

Sign In for Pricing
View Details
LINGO1 Antibody
OACA09034-50UL 50 µL

LINGO1 Antibody

Sign In for Pricing
View Details
AA960436 siRNA (m)
sc-140724 10 µM

AA960436 siRNA (m)

Sign In for Pricing
View Details
MCL1 Antibody
orb3160025-01 50 µL

MCL1 Antibody

Sign In for Pricing
View Details
MCL1 Antibody
orb3160025-02 100 µL

MCL1 Antibody

Sign In for Pricing
View Details
WTX CRISPR Activation Plasmid (h2)
sc-409039-ACT-2 20 µg

WTX CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details