Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK3 Peptide - C-terminal region

MAPKAPK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3PK, MK-3, MAPKAP3, MAPKAP-K3, MAPKAPK-3

UniProt

Q16644

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK3 Rabbit Polyclonal Antibody (orb589935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001230854.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Factor XII heavy chain Antibody (10-11-37) - BSA Free
NBP2-41377-0.025mg 0.025 mg

Mouse Monoclonal Factor XII heavy chain Antibody (10-11-37) - BSA Free

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human Transthyretin / Prealbumin (21-147) Membrane Protein, PaRoom Temperatureial, -His tag
MP0463F Each

Magic™ Antibody Discovery - Human Transthyretin / Prealbumin (21-147) Membrane Protein, PaRoom Temperatureial, -His tag

Sign In for Pricing
View Details
IL-17RD Polyclonal Antibody, FITC Conjugated
bs-2608R-FITC-01 20 µL

IL-17RD Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
IL-17RD Polyclonal Antibody, FITC Conjugated
bs-2608R-FITC-02 100 µL

IL-17RD Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human ZNF143 Protein, N-His
orb3058259-01 50 µg

Recombinant Human ZNF143 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ZNF143 Protein, N-His
orb3058259-02 100 µg

Recombinant Human ZNF143 Protein, N-His

Sign In for Pricing
View Details