RASGRP2 Peptide - middle region
RASGRP2 Peptide - middle region
Product Specifications
Product Name Alternative
CDC25L, CALDAG-GEFI
UniProt
Q7LDG7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASGRP2 Rabbit Polyclonal Antibody (orb589937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001092140.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTP
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV781786 1.0 µg DNA
RPS2P31 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
bs-10757R-BF350-01 20 µL
GPM6A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details 
bs-10757R-BF350-02 100 µL
GPM6A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details 
MBS1121214-01 0.02 mg (E-Coli)
Recombinant Danio rerio Regulator of nonsense transcripts 3A (upf3a)
Sign In for Pricing
View Details MBS1121214-02 0.02 mg (Yeast)
Recombinant Danio rerio Regulator of nonsense transcripts 3A (upf3a)
Sign In for Pricing
View Details