Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP2 Peptide - middle region

RASGRP2 Peptide - middle region

Product Specifications

Product Name Alternative

CDC25L, CALDAG-GEFI

UniProt

Q7LDG7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRP2 Rabbit Polyclonal Antibody (orb589937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001092140.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTP

More Discoveries

Explore Other Products

Browse additional items from our catalog

10MTR Tubing Red Rubber 10mm Bore 2mm Wall
TUB4008 10 m

10MTR Tubing Red Rubber 10mm Bore 2mm Wall

Sign In for Pricing
View Details
TXNDC11 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
48868065 1.0 µg DNA

TXNDC11 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human CRYBB3 shRNA Plasmid
abx950998-01 150 µg

Human CRYBB3 shRNA Plasmid

Sign In for Pricing
View Details
Human CRYBB3 shRNA Plasmid
abx950998-02 300 µg

Human CRYBB3 shRNA Plasmid

Sign In for Pricing
View Details
Phospho-MAP4K4 (Ser629) Rabbit Polyclonal Antibody (Biotin)
orb501247 100 µL

Phospho-MAP4K4 (Ser629) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PRSS50 ELISA Kit (Human) (OKDD00485)
OKDD00485 96 Well

PRSS50 ELISA Kit (Human) (OKDD00485)

Sign In for Pricing
View Details