Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1B1 Peptide - C-terminal region

ALDH1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH5, ALDHX

UniProt

P30837

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1B1 Rabbit Polyclonal Antibody (orb589938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000683.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM222 (h) -PR
sc-88035-PR 10 µM - 20 µL

TMEM222 (h) -PR

Sign In for Pricing
View Details
Camel Matrix Metalloproteinase 26 ELISA Kit
MBS079794-01 48 Well

Camel Matrix Metalloproteinase 26 ELISA Kit

Sign In for Pricing
View Details
Camel Matrix Metalloproteinase 26 ELISA Kit
MBS079794-02 96 Well

Camel Matrix Metalloproteinase 26 ELISA Kit

Sign In for Pricing
View Details
Camel Matrix Metalloproteinase 26 ELISA Kit
MBS079794-03 5x 96 Well

Camel Matrix Metalloproteinase 26 ELISA Kit

Sign In for Pricing
View Details
Camel Matrix Metalloproteinase 26 ELISA Kit
MBS079794-04 10x 96 Well

Camel Matrix Metalloproteinase 26 ELISA Kit

Sign In for Pricing
View Details
AMOT Antibody (Phospho-Ser1041)
OAAB16239-400UL 400 µL

AMOT Antibody (Phospho-Ser1041)

Sign In for Pricing
View Details