Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1B1 Peptide - C-terminal region

ALDH1B1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH5, ALDHX

UniProt

P30837

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDH1B1 Rabbit Polyclonal Antibody (orb589938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000683.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Val-Pro-Arg-MCA TFA
BUP01332-01 1 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Boc-Val-Pro-Arg-MCA TFA
BUP01332-02 5 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Boc-Val-Pro-Arg-MCA TFA
BUP01332-03 10 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Boc-Val-Pro-Arg-MCA TFA
BUP01332-04 25 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Boc-Val-Pro-Arg-MCA TFA
BUP01332-05 50 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details
Boc-Val-Pro-Arg-MCA TFA
BUP01332-06 100 mg

Boc-Val-Pro-Arg-MCA TFA

Sign In for Pricing
View Details