Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS26A Peptide - C-terminal region

VPS26A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HB58, PEP8A, VPS26, Hbeta58

UniProt

O75436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS26A Rabbit Polyclonal Antibody (orb589942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001030337.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d2 (NM_198664) Mouse Tagged Lenti ORF Clone
MR212945L3 10 µg

Tbc1d2 (NM_198664) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD49e HC Blocking Peptide
CBP1612-01 1 mg

CD49e HC Blocking Peptide

Sign In for Pricing
View Details
CD49e HC Blocking Peptide
CBP1612-02 5 mg

CD49e HC Blocking Peptide

Sign In for Pricing
View Details
CKM Protein Lysate (Rat) with C-HA Tag
16220036 100 µg

CKM Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Snx5 Mouse shRNA Plasmid (Locus ID 69178)
TL504273 1 Kit

Snx5 Mouse shRNA Plasmid (Locus ID 69178)

Sign In for Pricing
View Details
SLC35F1 AAV Vector (Human) (CMV)
44147101 1 µg

SLC35F1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details