Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS26A Peptide - C-terminal region

VPS26A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HB58, PEP8A, VPS26, Hbeta58

UniProt

O75436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS26A Rabbit Polyclonal Antibody (orb589942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001030337.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum dnaK Protein (aa 1-623) (strain 657 / Type Ba4)
VAng-Lsx8175-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum dnaK Protein (aa 1-623) (strain 657 / Type Ba4)

Sign In for Pricing
View Details
NDUFV1 Peptide
DF9668-BP 1 mg

NDUFV1 Peptide

Sign In for Pricing
View Details
GCC1-set siRNA/shRNA/RNAi Lentivector (Human)
21373091 4x 500 ng

GCC1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) (NM_001127687) Human Untagged Clone
SC323012 10 µg

Adiponectin Receptor 1 (ADIPOR1) (NM_001127687) Human Untagged Clone

Sign In for Pricing
View Details
IQGAP1 Polyclonal Antibody
orb1413319 100 µL

IQGAP1 Polyclonal Antibody

Sign In for Pricing
View Details
Benzoylacetone
BUP19972 10 g

Benzoylacetone

Sign In for Pricing
View Details