Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS26A Peptide - C-terminal region

VPS26A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HB58, PEP8A, VPS26, Hbeta58

UniProt

O75436

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS26A Rabbit Polyclonal Antibody (orb589942) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001030337.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-17B Antibody (B-B57) [CoraFluor 1]
NBP3-18114CL1 0.1 mL

Mouse Monoclonal IL-17B Antibody (B-B57) [CoraFluor 1]

Sign In for Pricing
View Details
CASP8AP2 ELISA Kit (Rat) (OKCD04511)
OKCD04511 96 Well

CASP8AP2 ELISA Kit (Rat) (OKCD04511)

Sign In for Pricing
View Details
PIK3R5 Protein Vector (Mouse) (pPB-C-His)
PV216258 500 ng

PIK3R5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Anti TPPP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC)
IRBAMLTPPPAP054120UL 1 Each

Rabbit Anti TPPP Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC)

Sign In for Pricing
View Details
Anti-Human UBE2T Polyclonal Antibody
HP958014-01 50 µg

Anti-Human UBE2T Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human UBE2T Polyclonal Antibody
HP958014-02 100 µg

Anti-Human UBE2T Polyclonal Antibody

Sign In for Pricing
View Details