Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDH1 Peptide - middle region

BDH1 Peptide - middle region

Product Specifications

Product Name Alternative

BDH, SDR9C1

UniProt

Q02338

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BDH1 Rabbit Polyclonal Antibody (orb589943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004042.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAB2 Rabbit Polyclonal Antibody
orb394705-01 50 µg

PRKAB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRKAB2 Rabbit Polyclonal Antibody
orb394705-02 100 µg

PRKAB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
c-Raf  Antibody
ABD6026 100 µg

c-Raf Antibody

Sign In for Pricing
View Details
Anthrax Spore extract antigen Monoclonal Antibodies, clone VA102
VACY-1022-CY739 Each

Anthrax Spore extract antigen Monoclonal Antibodies, clone VA102

Sign In for Pricing
View Details
NMDAR2B Colorimetric Cell-Based ELISA Kit
MBS9500426-01 1 Kit

NMDAR2B Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
NMDAR2B Colorimetric Cell-Based ELISA Kit
MBS9500426-02 5x 1 Kit

NMDAR2B Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details