ST5 Peptide - N-terminal region
ST5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HTS1, p126, DENND2B
UniProt
P78524
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ST5 Rabbit Polyclonal Antibody (orb589586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005409.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSACRYPSHSSSRVLLKDRHPPAPSPQNPQDPSPDTSPPTCPFKTASFGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471810-100 1x 100 µL
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC426858 20 µg
alpha 1 Antitrypsin (SERPINA1) (NM_001127700) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUB1932-100 1x 100 µL
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), 0.2mg/mL
Sign In for Pricing
View Details 
