ST5 Peptide - N-terminal region
ST5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HTS1, p126, DENND2B
UniProt
P78524
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ST5 Rabbit Polyclonal Antibody (orb589586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005409.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TSACRYPSHSSSRVLLKDRHPPAPSPQNPQDPSPDTSPPTCPFKTASFGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN422010 1 Kit
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
E-UNEL-H0215-01 5x 96 Tests
Uncoated Human PDGF-AA (Platelet Derived Growth Factor AA) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0215-02 15x 96 Tests
Uncoated Human PDGF-AA (Platelet Derived Growth Factor AA) ELISA Kit
Sign In for Pricing
View Details