Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CL1 Peptide - middle region

CX3CL1 Peptide - middle region

Product Specifications

Product Name Alternative

NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine, fractalkine, neurotactin

UniProt

P78423

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CX3CL1 Rabbit Polyclonal Antibody (orb589589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mat Support for 21 x 31 cm Gel Dryer
CSL-M2131 1 Each

Mat Support for 21 x 31 cm Gel Dryer

Sign In for Pricing
View Details
M71-33-427-YL AF Systems Consumables
114818 Box of 100 Label(s)

M71-33-427-YL AF Systems Consumables

Sign In for Pricing
View Details
MTTAS Protein Vector (Human) (pPM-C-His)
PV102873 500 ng

MTTAS Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ASMEPM-37X230MM-LOW PRESSURE STEAM Pipe Markers for Steam
312925 3 Card (3 Marker (s) x 1 Pack)

ASMEPM-37X230MM-LOW PRESSURE STEAM Pipe Markers for Steam

Sign In for Pricing
View Details
LOC503435 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV641622 1.0 µg DNA

LOC503435 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
TFRC (Transferrin Receptor, T9, TR, TFR, p90, CD71, TFR1, TRFR)
214430 100 µL

TFRC (Transferrin Receptor, T9, TR, TFR, p90, CD71, TFR1, TRFR)

Sign In for Pricing
View Details