Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX3CL1 Peptide - middle region

CX3CL1 Peptide - middle region

Product Specifications

Product Name Alternative

NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine, fractalkine, neurotactin

UniProt

P78423

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CX3CL1 Rabbit Polyclonal Antibody (orb589589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002987.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glutamate [NMDA] receptor subunit 3B (GRIN3B) , partial
MBS1092574-01 1 mg (E-Coli)

Recombinant Human Glutamate [NMDA] receptor subunit 3B (GRIN3B) , partial

Sign In for Pricing
View Details
Recombinant Human Glutamate [NMDA] receptor subunit 3B (GRIN3B) , partial
MBS1092574-02 1 mg (Yeast)

Recombinant Human Glutamate [NMDA] receptor subunit 3B (GRIN3B) , partial

Sign In for Pricing
View Details
Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit
MBS9352189-01 48 Well

Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit

Sign In for Pricing
View Details
Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit
MBS9352189-02 96 Well

Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit

Sign In for Pricing
View Details
Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit
MBS9352189-03 5x 96 Well

Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit

Sign In for Pricing
View Details
Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit
MBS9352189-04 10x 96 Well

Monkey Roundabout Homolog 2 (ROBO2) ELISA Kit

Sign In for Pricing
View Details