Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL21R Peptide - middle region

IL21R Peptide - middle region

Product Specifications

Product Name Alternative

NILR, CD360

UniProt

Q9HBE5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL21R Rabbit Polyclonal Antibody (orb589591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068570.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK12 Rabbit Polyclonal Antibody
TA372840 100 µL

KCNK12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERF Antibody
8C10666-AAT 50 µg

ERF Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (N501Y) (His Tag), Biotinylated
PKSV030353 20 µg

Recombinant SARS-CoV-2 Spike RBD (N501Y) (His Tag), Biotinylated

Sign In for Pricing
View Details
Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate
LY434240 100 µg

Dermokine (DMKN) (NM_001190347) Human Over-expression Lysate

Sign In for Pricing
View Details
ELF4 Mouse Monoclonal Antibody [Clone ID: OTI5E4]
CF810095 100 µg

ELF4 Mouse Monoclonal Antibody [Clone ID: OTI5E4]

Sign In for Pricing
View Details
NLRP3 (NM_004895) Human Over-expression Lysate
LC401526 20 µg

NLRP3 (NM_004895) Human Over-expression Lysate

Sign In for Pricing
View Details