IL21R Peptide - middle region
IL21R Peptide - middle region
Product Specifications
Product Name Alternative
NILR, CD360
UniProt
Q9HBE5
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL21R Rabbit Polyclonal Antibody (orb589591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068570.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH031517-01 100 µg
Recombinant Human NKG2D/CD314 Protein (aa 78-216, His Tag)
Sign In for Pricing
View Details PKSH031517-02 1 mg
Recombinant Human NKG2D/CD314 Protein (aa 78-216, His Tag)
Sign In for Pricing
View Details 
BNCB2026-100 1x 100 µL
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 