PLA2G4B Peptide - C-terminal region
PLA2G4B Peptide - C-terminal region
Product Specifications
Product Name Alternative
HsT16992, cPLA2-beta
UniProt
P0C869
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb589607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001108105.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SFREYSAPGVRRTPEEAAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC434052 20 µg
glutathione S transferase Omega 1 (GSTO1) (NM_001191002) Human Over-expression Lysate
Sign In for Pricing
View Details 
![(S)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine](https://cdn.genprice.uk/products/572/5033025096557/imageurl/trc-p318774-500mg.webp)
TRC-P318774-500MG 500 mg
(S)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
Sign In for Pricing
View Details