Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4B Peptide - C-terminal region

PLA2G4B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT16992, cPLA2-beta

UniProt

P0C869

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb589607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001108105.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SFREYSAPGVRRTPEEAAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Ethanedisulfonic Acid Diethyl Ester
TRC-E676515-5G 5 g

1,2-Ethanedisulfonic Acid Diethyl Ester

Sign In for Pricing
View Details
RPS19 (NM_001022) Human Recombinant Protein
TP720148L 500 µg

RPS19 (NM_001022) Human Recombinant Protein

Sign In for Pricing
View Details
VAMP1 Antibody
KC-1781-01 50 μL

VAMP1 Antibody

Sign In for Pricing
View Details
VAMP1 Antibody
KC-1781-02 100 µL

VAMP1 Antibody

Sign In for Pricing
View Details
VAMP1 Antibody
KC-1781-03 1 mL

VAMP1 Antibody

Sign In for Pricing
View Details
Intersectin 1 (ITSN1) Human Gene Knockout Kit (CRISPR)
KN421701 1 Kit

Intersectin 1 (ITSN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details