Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPP Peptide - C-terminal region

CLPP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFNB81, PRLTS3

UniProt

Q16740

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPP Rabbit Polyclonal Antibody (orb589608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JP-45 CRISPR Activation Plasmid (h2)
sc-414266-ACT-2 20 µg

JP-45 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Sheep Nucleoporin 153kDa ELISA Kit
MBS745342-01 48 Well

Sheep Nucleoporin 153kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 153kDa ELISA Kit
MBS745342-02 96 Well

Sheep Nucleoporin 153kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 153kDa ELISA Kit
MBS745342-03 5x 96 Well

Sheep Nucleoporin 153kDa ELISA Kit

Sign In for Pricing
View Details
Sheep Nucleoporin 153kDa ELISA Kit
MBS745342-04 10x 96 Well

Sheep Nucleoporin 153kDa ELISA Kit

Sign In for Pricing
View Details
ADCY5 Polyclonal Antibody, Cy7 Conjugated
bs-3922R-Cy7-01 20 µL

ADCY5 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details