Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPP Peptide - C-terminal region

CLPP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFNB81, PRLTS3

UniProt

Q16740

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPP Rabbit Polyclonal Antibody (orb589608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006003.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
TA809074S 30 µL

LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI6D11]

Sign In for Pricing
View Details
Lentiviral human PPP1R16A shRNA (UAS) - Lentiviral human PPP1R16A shRNA (UAS, GFP) (25)
GTR15330023 1 Vial

Lentiviral human PPP1R16A shRNA (UAS) - Lentiviral human PPP1R16A shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
EHF Antibody
CSB-PA007494ESR2HU-01 50 μL

EHF Antibody

Sign In for Pricing
View Details
EHF Antibody
CSB-PA007494ESR2HU-02 100 µL

EHF Antibody

Sign In for Pricing
View Details
MUC5AC (Mucin 5AC / Gastric Mucin) (1-13M1), CF488A conjugate, 0.1mg/mL
BNC880432-500 1x 500 µL

MUC5AC (Mucin 5AC / Gastric Mucin) (1-13M1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C7orf30 Rabbit Polyclonal Antibody (PE-Cy5)
orb913092 100 µL

C7orf30 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details