Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200 Peptide - C-terminal region

CD200 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRC, MOX1, MOX2, OX-2

UniProt

P41217

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD200 Rabbit Polyclonal Antibody (orb589620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001004196.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Mouse IL1B  Monoclonal Antibody
MBS2544479-01 0.06 mL

Rabbit anti Mouse IL1B  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Mouse IL1B  Monoclonal Antibody
MBS2544479-02 0.12 mL

Rabbit anti Mouse IL1B  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Mouse IL1B  Monoclonal Antibody
MBS2544479-03 0.2 mL

Rabbit anti Mouse IL1B  Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Senp3 shRNA (UAS) - Lentiviral mouse Senp3 shRNA (UAS, RFP) plasmid
GTR15121405 1 Vial

Lentiviral mouse Senp3 shRNA (UAS) - Lentiviral mouse Senp3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Phospho-ILK (Ser343) Antibody
AF8070-01 100 µL

Phospho-ILK (Ser343) Antibody

Sign In for Pricing
View Details
Phospho-ILK (Ser343) Antibody
AF8070-02 200 µL

Phospho-ILK (Ser343) Antibody

Sign In for Pricing
View Details